PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_000357-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 454aa    MW: 51160.6 Da    PI: 8.551
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_000357-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.1e-152569348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd +l + + ++G+++W+ Ia+++   +t  qc+ rw++yl
  AHYPO_000357-RA 25 TWTQEEDNILREQISKHGTENWTVIASKFK-DKTTRQCRRRWYTYL 69
                     6****************************9.*************97 PP

2Myb_DNA-binding43.76.2e-1475118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
  AHYPO_000357-RA  75 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 118
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2131869IPR017930Myb domain
SMARTSM007173.7E-142271IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-2623116IPR009057Homeodomain-like
CDDcd001671.03E-132569No hitNo description
PfamPF139214.1E-162686No hitNo description
Gene3DG3DSA:1.10.10.604.6E-212677IPR009057Homeodomain-like
PROSITE profilePS5129420.53870124IPR017930Myb domain
SMARTSM007171.1E-1474122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-1978123IPR009057Homeodomain-like
CDDcd001672.37E-1078119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MTTLQKKQER NEESSTKPKE RRIVTWTQEE DNILREQISK HGTENWTVIA SKFKDKTTRQ  60
CRRRWYTYLN SDFKKGGWSP EEDMLLCEAQ KIFGNRWTEI AKVVSGRTDN AVKNRFSTLC  120
KKKAKREALA KENNNTFINM NNKRILIDSN GFHPKAMVDI ASPLKKLRRA HIPDHAENFN  180
SGNIGHKECL LAKQHPRLPF AVLAQNVRNV DSSKVFSVKE TSINGDKKFE GAFLKKDDPK  240
VAALVQQAAL LSSLAVKVNM DNTKQSLENA WKVLHNFFGR SKENEELRYK TEDVDLQIND  300
LKDSLENLIS NDEVIDPSQR QLDVYESPSS SEYSTGSTNL SACDQGEHSL AEISTFHEDI  360
GATSNSTQIA SNGYVDITNN KLIPCPTTDQ EICSPIQVTP IFRSLASAVP SPQFSESERH  420
FLLKTLGIDS PTHNTINNPL QAPPCRKALL QGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-292612410108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683232.10.0PREDICTED: uncharacterized protein LOC104897953
RefseqXP_010683234.10.0PREDICTED: uncharacterized protein LOC104897953
TrEMBLA0A0K9RRN20.0A0A0K9RRN2_SPIOL; Uncharacterized protein
STRINGVIT_01s0026g01910.t011e-175(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-125myb domain protein 88